PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g03170.1.p
Common NameBRADI_3g03170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 743aa    MW: 78182.9 Da    PI: 6.2775
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g03170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK841.4e-26510558452
            RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        + l++l+ yFs+++kdAA++Lgvc+T++KriCRq+GI+RWP+Rki+++
  Bradi3g03170.1.p 510 PVGLKELQGYFSGSLKDAARSLGVCPTTMKRICRQHGISRWPFRKISKV 558
                       67899*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.859493578IPR003035RWP-RK domain
PfamPF020422.6E-24511558IPR003035RWP-RK domain
SuperFamilySSF542775.89E-19632704No hitNo description
SMARTSM006663.1E-17635728IPR000270PB1 domain
PROSITE profilePS5174519.08635730IPR000270PB1 domain
CDDcd064071.66E-34636729No hitNo description
Gene3DG3DSA:3.10.20.2401.3E-22636702No hitNo description
PfamPF005644.6E-13636705IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MGVDADVERV LSLRLGDRDA GSDGESASGG SGGGGAVKER IARALRLYKE SSSSSGAGGE  60
EGALLLQVWA PVAAGGRRVL ATRGQPFLVL AAAASPSSSA PARCCRRRLL QYRAVSLAHV  120
FSVDGDGECV SWEERGLPGR AFDAGAAEWT PNVQLYGAGE YARVSHALVH DVQGSLALPV  180
LDPAATGRRC LAVIEMVTTA PMACFAAEAH KLCKALQAVA LRGSEICYSL PAKIPNPEAT  240
RAAMSEVSHL LATVAGAHQL PLAQAWVRCK RCSSSSSTDT VHDDGDEHIS LTTAGAPFHL  300
TAGSGFRDAC TEHHLHAGQG AVGEAAVSGS PSFCVDIARR SKAAYPLAHY ARLHGLAGCL  360
AVPLWLRRFA MHEDAGSEDE EECVLLEFFL PPDCRGVDEQ KAAVEAVAAT VREECSGDGL  420
KAMSGLRDLS LEAVFADGVH TITVADAAAH ELNDHGDFGR GDSDEEDEHL AVDVAGGDLA  480
VNIHGADQNG VGDGVSQPEK KKTGRKAGKP VGLKELQGYF SGSLKDAARS LGVCPTTMKR  540
ICRQHGISRW PFRKISKVNR ALSKIRRAAI ESEDCSPKPV AASSSHPAPD PQNLCLSSAL  600
GDTSSQGSSQ EPPPLTRTAL PKSLLRHSNG ADREVVTIKA SYREDIIRFR VPCSSGITAV  660
KEEVAKRLGL DASGFDVKYL DDDHEWVLLS CDADFQECLD VAPVLPPSAS AAAHGARQVS  720
PVVRLMVQEV ADNLRRFCGS SD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755490.10.0PREDICTED: protein NLP3-like
TrEMBLA0A0Q3PUU30.0A0A0Q3PUU3_BRADI; Uncharacterized protein
TrEMBLI1HWY90.0I1HWY9_BRADI; Uncharacterized protein
STRINGBRADI3G03170.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62692939
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-124Nin-like family protein